PDB entry 1wae

View 1wae on RCSB PDB site
Description: Crystal structure of H129V Mutant of Alcaligenes Xylosoxidans Nitrite Reductase
Class: oxidoreductase
Keywords: copper protein, oxidoreductase
Deposited on 2004-10-26, released 2004-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601
      • engineered mutation (128)
    Domains in SCOPe 2.07: d1waea1, d1waea2
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1waeA (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyvcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1waeA (A:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyvcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapip