PDB entry 1wa2

View 1wa2 on RCSB PDB site
Description: crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase with nitrite bound
Class: reductase
Keywords: reductase, nitrite reductase, h313q mutant, no2, denitrification
Deposited on 2004-10-22, released 2005-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.182
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dissimilatory copper-containing nitrite reductase,
    Species: ALCALIGENES XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601
      • engineered mutation (312)
    Domains in SCOPe 2.06: d1wa2x1, d1wa2x2
  • Heterogens: CU, ZN, NO2, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1wa2X (X:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaagqikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa2X (X:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaagqikvegkwnddlmkqikapapip