SCOP 1.75: Structural Classification of Proteins

PDB entry 1w8r

View 1w8r on RCSB PDB site
Description: the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates
Class: lyase
Keywords: aldolase, fructose 1, 6-bisphosphate, tim barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase
Deposited on 2004-09-27, released 2005-03-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.149
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8ra1
Chain 'B':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8rb1
Chain 'C':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8rc1
Chain 'D':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8rd1
Chain 'E':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8re1
Chain 'F':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8rf1
Chain 'G':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8rg1
Chain 'H':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8rh1
Chain 'I':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8ri1
Chain 'J':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
  - engineered mutation (145)
Domains in SCOP 1.75: d1w8rj1
Heterogens: F2P, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1w8rA (A:)
manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgadamkiky
tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
lkfaralaelvyggkklaeplnv