PDB entry 1w8l

View 1w8l on RCSB PDB site
Description: Enzymatic and structural characterization of non peptide ligand cyclophilin complexes
Class: isomerase
Keywords: complex (isomerase-immunosuppressant), non-peptide ligand, isomerase, multigene family, rotamase
Deposited on 2004-09-23, released 2004-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W8L (0-0)
    • Uniprot P62937 (1-164)
    Domains in SCOPe 2.08: d1w8la_
  • Heterogens: 1P3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1w8lA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle