PDB entry 1w69

View 1w69 on RCSB PDB site
Description: crystal structure of mouse ribonucleotide reductase subunit r2 under reducing conditions. a fully occupied dinuclear iron cluster and bound acetate.
Class: reductase
Keywords: reductase, ribonucleotide reductase, DNA replication, diiron oxygen protein, tyrosyl radical, metal-binding, oxidoreductase
Deposited on 2004-08-16, released 2004-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase m2 chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w69a_
  • Heterogens: FE2, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w69A (A:)
    mlsvrtplatiadqqqlqlsplkrltladkentpptlsstrvlaskaarrifqdsaeles
    kaptnpsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhweal
    kpderhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysll
    idtyikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgs
    fasifwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavri
    eqefltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfmenislegkt
    nffekrvgeyqrmgvmsnstensftldadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w69A (A:)
    vedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpderhf
    ishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidtyikd
    pkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwl
    kkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqeflte
    alpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpf