PDB entry 1w3c

View 1w3c on RCSB PDB site
Description: crystal structure of the hepatitis c virus ns3 protease in complex with a peptidomimetic inhibitor
Deposited on 2004-07-14, released 2004-12-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-09, with a file datestamp of 2004-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w3c.1
  • Chain 'B':
    Domains in SCOP 1.71: d1w3c.2
  • Chain 'C':
    Domains in SCOP 1.71: d1w3c.1
  • Chain 'D':
    Domains in SCOP 1.71: d1w3c.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w3cA (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3cA (A:)
    itaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgagsk
    tlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrgds
    rgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w3cB (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3cB (B:)
    itaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgagsk
    tlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrgds
    rgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesme
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w3cC (C:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3cC (C:)
    gsvvivgriilsg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w3cD (D:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w3cD (D:)
    gsvvivgriilsg