PDB entry 1w26

View 1w26 on RCSB PDB site
Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins
Class: chaperone
Keywords: chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase
Deposited on 2004-06-28, released 2004-09-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.241
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trigger Factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1w26a1, d1w26a2, d1w26a3
  • Chain 'B':
    Compound: Trigger Factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1w26b1, d1w26b2, d1w26b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w26A (A:)
    mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
    svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
    eaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefegg
    kasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkv
    eerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandi
    dvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnel
    kadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtek
    ettfnelmnqqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w26B (B:)
    mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
    svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
    eaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefegg
    kasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkv
    eerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandi
    dvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnel
    kadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtek
    ettfnelmnqqa