PDB entry 1w08

View 1w08 on RCSB PDB site
Description:
Deposited on 2004-06-02, released 2004-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-10, with a file datestamp of 2004-06-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18487
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1w08a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w08A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgknpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv