PDB entry 1vzo

View 1vzo on RCSB PDB site
Description: the structure of the n-terminal kinase domain of msk1 reveals a novel autoinhibitory conformation for a dual kinase protein
Class: transferase
Keywords: protein kinase, transferase, phosphorylation, serine/threonine protein kinase
Deposited on 2004-05-21, released 2004-06-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s6 kinase alpha 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VZO
      • engineered mutation (218)
    • Uniprot O75582
    Domains in SCOPe 2.03: d1vzoa_
  • Heterogens: BME, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzoA (A:)
    mahhhhhheeeggssggaagtsadggdggeqlltvkhelrtanltghaekvgienfellk
    vlgtgaygkvflvrkisghdtgklyamkvlkkativqkakttehtrterqvlehirqspf
    lvtlhyafqtetklhlildyinggelfthlsqrerftehevqiyvgeivlalehlhklgi
    iyrdiklenilldsnghvvltdfglskefvadeteraydfcgtieymapdivrggdsghd
    kavdwwslgvlmyelltgaspftvdgeknsqaeisrrilkseppypqemsalakdliqrl
    lmkdpkkrlgcgprdadeikehlffqkinwddlaakkvpapfkpvirdeldvsnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzoA (A:)
    qlltvkhelrtanltghaekvgienfellkvlgtgaygkvflvrkisghdtgklyamkvl
    kkativqkakttehtrterqvlehirqspflvtlhyafqtetklhlildyinggelfthl
    sqrerftehevqiyvgeivlalehlhklgiiyrdiklenilldsnghvvltdfglskefv
    adeteraydfcgtieymapdivrggddkavdwwslgvlmyelltgaspftvdgeknsqae
    isrrilkseppypqemsalakdliqrllmkdpkkrlgcgprdadeikehlffqkinwddl
    aakkvpapfkpvirdeldv