PDB entry 1vyn

View 1vyn on RCSB PDB site
Description: structure and nucleic acid binding of the drosophila argonaute2 paz domain
Class: nucleic acid binding
Keywords: nucleic acid binding, RNA interference
Deposited on 2004-05-03, released 2004-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: argonaute2
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYN (Start-3)
    • Uniprot Q9VUQ5 (4-End)
    Domains in SCOPe 2.06: d1vyna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vynA (A:)
    gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
    glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
    gqalnrkdgatqvanmikyaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vynA (A:)
    ampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls
    rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee