PDB entry 1vwp

View 1vwp on RCSB PDB site
Description: streptavidin complexed with cyclo-ac-[chpqgppc]-nh2 monomer, ph 2.5
Class: complex (biotin-binding protein/peptide)
Keywords: complex (biotin-binding protein/peptide), cyclic peptide discovered by phage display
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1vwpb_
  • Chain 'P':
    Compound: peptide ligand containing hpq
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VWP
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vwpB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vwpB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    v
    

  • Chain 'P':
    No sequence available.