PDB entry 1vwm

View 1vwm on RCSB PDB site
Description: streptavidin-cyclo-ac-[chpqfc]-nh2, ph 4.2
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOP 1.61 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.61: d1vwmb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vwmB (B:)
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v