PDB entry 1vwf

View 1vwf on RCSB PDB site
Description: streptavidin complexed with cyclo-ac-[chpqgppc]-nh2 monomer, ph 3.67
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOP 1.61 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Domains in SCOP 1.61: d1vwfb_

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vwfB (B:)
  aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
  lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
  v