PDB entry 1vsc

View 1vsc on RCSB PDB site
Description: vcam-1
Deposited on 1995-04-27, released 1996-06-20
The last revision prior to the SCOP 1.65 freeze date was dated 1996-06-20, with a file datestamp of 1996-06-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vscA (A:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vscB (B:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvd