PDB entry 1vs7
View 1vs7 on RCSB PDB site
Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
Class: ribosome
Keywords: ribosome, kasugamycin
Deposited on
2006-08-04, released
2006-09-26
The last revision prior to the SCOP 1.73 freeze date was dated
2006-11-21, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 3.46 Å
R-factor: 0.279
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 16S ribosomal RNA
Species: Escherichia coli
- Chain 'B':
Compound: 30S ribosomal protein S2
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: 30S ribosomal protein S3
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: 30S ribosomal protein S4
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: 30S ribosomal protein S5
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: 30S ribosomal protein S6
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: 30S ribosomal protein S7
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: 30S ribosomal protein S8
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1vs7h1 - Chain 'I':
Compound: 30S ribosomal protein S9
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: 30S ribosomal protein S10
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: 30S ribosomal protein S11
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: 30S ribosomal protein S12
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: 30S ribosomal protein S13
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: 30S ribosomal protein S14
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: 30S ribosomal protein S15
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: 30S ribosomal protein S16
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: 30S ribosomal protein S17
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'R':
Compound: 30S ribosomal protein S18
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'S':
Compound: 30S ribosomal protein S19
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'T':
Compound: 30S ribosomal protein S20
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Chain 'U':
Compound: 30S ribosomal protein S21
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Heterogens: KSG, MG, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
Sequence, based on SEQRES records: (download)
>1vs7H (H:)
msmqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpele
ltlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqag
lggeiicyva
Sequence, based on observed residues (ATOM records): (download)
>1vs7H (H:)
smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
ggeiicyva
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.
- Chain 'R':
No sequence available.
- Chain 'S':
No sequence available.
- Chain 'T':
No sequence available.
- Chain 'U':
No sequence available.