PDB entry 1vs7

View 1vs7 on RCSB PDB site
Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
Class: ribosome
Keywords: ribosome, kasugamycin
Deposited on 2006-08-04, released 2006-09-26
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.46 Å
R-factor: 0.279
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16S ribosomal RNA
  Species: Escherichia coli
  
• Chain 'B':
  Compound: 30S ribosomal protein S2
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V0
• Chain 'C':
  Compound: 30S ribosomal protein S3
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V3
• Chain 'D':
  Compound: 30S ribosomal protein S4
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V8 (Start-205)
• Chain 'E':
  Compound: 30S ribosomal protein S5
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7W1
• Chain 'F':
  Compound: 30S ribosomal protein S6
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02358 (0-End)
• Chain 'G':
  Compound: 30S ribosomal protein S7
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02359
• Chain 'H':
  Compound: 30S ribosomal protein S8
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7W7 (Start-129)
  Domains in SCOP 1.73: d1vs7h1
• Chain 'I':
  Compound: 30S ribosomal protein S9
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7X3 (Start-129)
• Chain 'J':
  Compound: 30S ribosomal protein S10
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7R5
• Chain 'K':
  Compound: 30S ribosomal protein S11
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7R9 (Start-128)
• Chain 'L':
  Compound: 30S ribosomal protein S12
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7S3 (Start-123)
• Chain 'M':
  Compound: 30S ribosomal protein S13
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7S9
• Chain 'N':
  Compound: 30S ribosomal protein S14
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG59 (Start-100)
• Chain 'O':
  Compound: 30S ribosomal protein S15
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8X9M2 (Start-88)
• Chain 'P':
  Compound: 30S ribosomal protein S16
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7T3 (0-End)
• Chain 'Q':
  Compound: 30S ribosomal protein S17
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG63 (Start-83)
• Chain 'R':
  Compound: 30S ribosomal protein S18
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7T7
• Chain 'S':
  Compound: 30S ribosomal protein S19
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7U3
• Chain 'T':
  Compound: 30S ribosomal protein S20
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7U7 (Start-86)
• Chain 'U':
  Compound: 30S ribosomal protein S21
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68679
• Heterogens: KSG, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >1vs7H (H:)
  msmqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpele
  ltlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqag
  lggeiicyva
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1vs7H (H:)
  smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
  tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
  ggeiicyva
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.