PDB entry 1vru

View 1vru on RCSB PDB site
Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes
Deposited on 1995-04-19, released 1996-04-03
The last revision prior to the SCOP 1.61 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.187
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vruA (A:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
    dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
    ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
    pivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaele
    laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
    ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
    vklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
    ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vruA (A:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
    dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
    ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
    pivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaele
    laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
    ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
    vklwyqlekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglev
    nivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vruB (B:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
    frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
    mddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqp
    ivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelel
    aenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtn
    dvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplv
    klwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vruB (B:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
    frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
    mddlyvgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvnd
    iqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhg
    vyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyargahtndvkqlteavqkitte
    siviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq