PDB entry 1vrf

View 1vrf on RCSB PDB site
Description: solution structure of component IV glycera dibranchiata monomeric hemoglobin-co
Class: heme protein
Keywords: heme protein, globin, oxygen transport
Deposited on 1999-03-25, released 1999-04-01
The last revision prior to the SCOP 1.73 freeze date was dated 1999-04-30, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (globin, monomeric component m-IV)
    Species: Glycera dibranchiata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vrfa_
  • Heterogens: HEM, CMO

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrfA (A:)
    glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs