PDB entry 1vrf

View 1vrf on RCSB PDB site
Description: solution structure of component iv glycera dibranchiata monomeric hemoglobin-co
Deposited on 1999-03-25, released 1999-04-01
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-30, with a file datestamp of 1999-05-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1vrfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrfA (A:)
    glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs