PDB entry 1vre

View 1vre on RCSB PDB site
Description: solution structure of component iv glycera dibranchiata monomeric hemoglobin-co
Deposited on 1999-03-25, released 1999-04-02
The last revision prior to the SCOP 1.59 freeze date was dated 1999-05-20, with a file datestamp of 1999-05-19.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1vrea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vreA (A:)
    glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs