PDB entry 1vre

View 1vre on RCSB PDB site
Description: solution structure of component IV glycera dibranchiata monomeric hemoglobin-co
Class: heme protein
Keywords: heme protein, globin, oxygen transport
Deposited on 1999-03-25, released 1999-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (globin, monomeric component m-IV)
    Species: Glycera dibranchiata [TaxId:6350]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vrea_
  • Heterogens: HEM, CMO

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vreA (A:)
    glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs