PDB entry 1vr6

View 1vr6 on RCSB PDB site
Description: Crystal structure of Phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) (TM0343) from Thermotoga Maritima at 1.92 A resolution
Class: transferase
Keywords: TM0343, PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE (EC 2.5.1.54) (DAHP SYNTHASE), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSFERASE
Deposited on 2005-02-14, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0343
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYH8 (12-349)
      • leader sequence (7-11)
    Domains in SCOPe 2.07: d1vr6a2, d1vr6a3
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0343
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYH8 (12-349)
      • leader sequence (8-11)
    Domains in SCOPe 2.07: d1vr6b2, d1vr6b3
  • Chain 'C':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0343
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYH8 (12-349)
      • leader sequence (7-11)
    Domains in SCOPe 2.07: d1vr6c2, d1vr6c3
  • Chain 'D':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0343
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYH8 (12-349)
      • leader sequence (9-11)
    Domains in SCOPe 2.07: d1vr6d2, d1vr6d3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr6A (A:)
    mgsdkihhhhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryv
    vadkfesldcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegre
    mlmetahflselgvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealge
    ddlpkvaeyadiiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansg
    ntkiilcergirtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraai
    avgahgiivevhpepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr6A (A:)
    hhhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfes
    ldcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetah
    flselgvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkva
    eyadiiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilc
    ergirtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgi
    ivevhpepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vr6B (B:)
    mgsdkihhhhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryv
    vadkfesldcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegre
    mlmetahflselgvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealge
    ddlpkvaeyadiiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansg
    ntkiilcergirtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraai
    avgahgiivevhpepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr6B (B:)
    hhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesl
    dcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahf
    lselgvkvlrggaykprsfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
    iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
    tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
    pepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vr6C (C:)
    mgsdkihhhhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryv
    vadkfesldcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegre
    mlmetahflselgvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealge
    ddlpkvaeyadiiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansg
    ntkiilcergirtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraai
    avgahgiivevhpepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr6C (C:)
    hhhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfes
    ldcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetah
    flselgvkvlrggaykprtfqglgekgleylreaadkygmyvvtealgeddlpkvaeyad
    iiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergi
    rtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivev
    hpepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vr6D (D:)
    mgsdkihhhhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryv
    vadkfesldcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegre
    mlmetahflselgvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealge
    ddlpkvaeyadiiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansg
    ntkiilcergirtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraai
    avgahgiivevhpepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr6D (D:)
    hhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesld
    cvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahfl
    selgvkvlrggaykprtspsfqglgekgleylreaadkygmyvvtealgeddlpkvaeya
    diiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcerg
    irtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiive
    vhpepekalsdgkqsldfelfkelvqemkkladalgvkvn