PDB entry 1vqh

View 1vqh on RCSB PDB site
Description: gene v protein mutant with ile 47 replaced by met 47 (i47m)
Class: DNA-binding protein
Keywords: DNA-binding protein, gene v, mutant
Deposited on 1996-08-14, released 1997-02-12
The last revision prior to the SCOP 1.73 freeze date was dated 1997-02-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene v protein
    Species: Bacteriophage f1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69543 (0-End)
      • engineered (46)
    Domains in SCOP 1.73: d1vqha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vqhA (A:)
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkmtldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

    Sequence, based on observed residues (ATOM records): (download) 
    >1vqhA (A:)
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkmtldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpa