PDB entry 1vpw

View 1vpw on RCSB PDB site
Description: structure of the purr mutant, l54m, bound to hypoxanthine and purf operator DNA
Class: transcription/DNA
Keywords: complex (DNA-binding protein/DNA), DNA-binding regulatory protein, minor groove bending, transcription/DNA complex
Deposited on 1998-02-27, released 1998-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.174
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7
      • engineered (52)
    Domains in SCOPe 2.06: d1vpwa1, d1vpwa2
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*ap*ap*ap*cp*gp*tp*tp*tp*gp*cp*gp*t )-3')
  • Heterogens: HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpwA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarsmkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpwA (A:)
    tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarsmkvnhtksi
    gllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvm
    cseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghreig
    vipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpta
    vfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetaf
    nmlldrivnkreepqsievhprlierrsvadgpfrdyr
    

  • Chain 'B':
    No sequence available.