PDB entry 1vps

View 1vps on RCSB PDB site
Description: polyomavirus vp1 pentamer complexed with a disialylated hexasaccharide
Class: Viral protein
Keywords: VIRUS COAT PROTEIN, OLIGOSACCHARIDE BINDING, VIRUS ASSEMBLY, SIALIC ACID, Viral protein
Deposited on 1997-03-07, released 1997-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vpsa_
  • Chain 'B':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vpsb_
  • Chain 'C':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vpsc_
  • Chain 'D':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vpsd_
  • Chain 'E':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vpse_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpsA (A:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpsA (A:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpsB (B:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vpsC (C:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpsC (C:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vpsD (D:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpsD (D:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vpsE (E:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpsE (E:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk