PDB entry 1vpo

View 1vpo on RCSB PDB site
Description: Crystal Structure Analysis of the Anti-testosterone Fab in Complex with Testosterone
Class: immune system
Keywords: fab fragment, anti-steroid, testosterone complex, IMMUNE SYSTEM
Deposited on 2004-11-15, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: -1.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-testosterone (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1VPO (0-220)
    Domains in SCOPe 2.07: d1vpoh1, d1vpoh2
  • Chain 'L':
    Compound: anti-testosterone (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1VPO (0-218)
    Domains in SCOPe 2.07: d1vpol1, d1vpol2
  • Heterogens: TES, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpoH (H:)
    evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpoL (L:)
    dvvvtqtplslpvslgdqasiscrssevivtrngytpiewylqkpgqspklliykaykrf
    pgvpdrfsgsgsgtdftlkisrveaedlgvyycfdgstvppkfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrdec