PDB entry 1vpn

View 1vpn on RCSB PDB site
Description: unassembled polyomavirus vp1 pentamer
Deposited on 1997-03-07, released 1997-05-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1vpna_
  • Chain 'B':
    Domains in SCOP 1.57: d1vpnb_
  • Chain 'C':
    Domains in SCOP 1.57: d1vpnc_
  • Chain 'D':
    Domains in SCOP 1.57: d1vpnd_
  • Chain 'E':
    Domains in SCOP 1.57: d1vpne_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpnA (A:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpnB (B:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpnC (C:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpnD (D:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpnE (E:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk