PDB entry 1vmj

View 1vmj on RCSB PDB site
Description: Crystal structure of a protein with unknown function from UPF0047 family (TM0723) from Thermotoga maritima at 1.52 A resolution
Class: structural genomics, unknown function
Keywords: TM0723, hypothetical protein, structural genomics, JCSG, protein structure initiative, PSI, Joint Center for Structural Genomics
Deposited on 2004-09-30, released 2004-10-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.145
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM0723
    Species: Thermotoga maritima MSB8
    Gene: TM0723
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vmja_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmjA (A:)
    mgsdkihhhhhhmksyrkelwfhtkrrrefinitplleecvresgikeglllcnamhita
    svfinddepglhhdfevwleklapekpysqykhndtgednadahlkrtimgrevviaitd
    rkmdlgpweqvfygefdgmrpkrvlvkiige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmjA (A:)
    mksyrkelwfhtkrrrefinitplleecvresgikeglllcnamhitasvfinddepglh
    hdfevwleklapekpysqykhndtgednadahlkrtimgrevviaitdrkmdlgpweqvf
    ygefdgmrpkrvlvkiige