PDB entry 1vmb

View 1vmb on RCSB PDB site
Description: Crystal structure of 30S ribosomal protein S6 (TM0603) from Thermotoga maritima at 1.70 A resolution
Deposited on 2004-09-16, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vmba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmbA (A:)
    mgsdkihhhhhhmayvkeriyesmfiiapnvpeeerenlvervkkiieervkgkidkver
    mgmrkfayeikkfnegdytviyfrcdgqnlqelenfyrvtpeiirwqtfrrfdlekkerk
    aqrekaaaeatesseggsed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmbA (A:)
    keriyesmfiiapnvpeeerenlvervkkiieervkgkidkvermgmrkfayeikkfneg
    dytviyfrcdgqnlqelenfyrvtpeiirwqtfrrfdlekkerkaqr