PDB entry 1vlj

View 1vlj on RCSB PDB site
Description: Crystal structure of NADH-dependent butanol dehydrogenase A (TM0820) from Thermotoga maritima at 1.78 A resolution
Class: oxidoreductase
Keywords: TM0820, NADH-DEPENDENT BUTANOL DEHYDROGENASE A, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-07-28, released 2004-08-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.145
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-dependent butanol dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZS7 (12-406)
      • leader sequence (9-11)
    Domains in SCOPe 2.05: d1vlja_
  • Chain 'B':
    Compound: NADH-dependent butanol dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZS7 (12-406)
      • leader sequence (7-11)
    Domains in SCOPe 2.05: d1vljb_
  • Heterogens: FE, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vljA (A:)
    mgsdkihhhhhhmenfvfhnptkivfgrgtipkigeeiknagirkvlflygggsikkngv
    ydqvvdslkkhgiewvevsgvkpnpvlskvheavevakkekveavlgvgggsvvdsakav
    aagalyegdiwdafigkyqiekalpifdvltisatgtemngnavitnektkekygvsska
    lypkvsiidpsvqftlpkeqtvygavdaishileyyfdgsspeisneiaegtirtimkmt
    erliekpddyearanlawsatialngtmavgrrggewachriehslsalydiahgaglai
    vfpawmkyvyrknpaqferfakkifgfegegeelilkgieafknwlkkvgapvslkdagi
    peedidkivdnvmllveknlkpkgaslgrimvleredvreilklaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vljA (A:)
    hhhmenfvfhnptkivfgrgtipkigeeiknagirkvlflygggsikkngvydqvvdslk
    khgiewvevsgvkpnpvlskvheavevakkekveavlgvgggsvvdsakavaagalyegd
    iwdafigkyqiekalpifdvltisatgtemngnavitnektkekygvsskalypkvsiid
    psvqftlpkeqtvygavdaishileyyfdgsspeisneiaegtirtimkmterliekpdd
    yearanlawsatialngtmavgrrggewachriehslsalydiahgaglaivfpawmkyv
    yrknpaqferfakkifgfegegeelilkgieafknwlkkvgapvslkdagipeedidkiv
    dnvmllveknlkpkgaslgrimvleredvreilklaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vljB (B:)
    mgsdkihhhhhhmenfvfhnptkivfgrgtipkigeeiknagirkvlflygggsikkngv
    ydqvvdslkkhgiewvevsgvkpnpvlskvheavevakkekveavlgvgggsvvdsakav
    aagalyegdiwdafigkyqiekalpifdvltisatgtemngnavitnektkekygvsska
    lypkvsiidpsvqftlpkeqtvygavdaishileyyfdgsspeisneiaegtirtimkmt
    erliekpddyearanlawsatialngtmavgrrggewachriehslsalydiahgaglai
    vfpawmkyvyrknpaqferfakkifgfegegeelilkgieafknwlkkvgapvslkdagi
    peedidkivdnvmllveknlkpkgaslgrimvleredvreilklaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vljB (B:)
    hhhhhmenfvfhnptkivfgrgtipkigeeiknagirkvlflygggsikkngvydqvvds
    lkkhgiewvevsgvkpnpvlskvheavevakkekveavlgvgggsvvdsakavaagalye
    gdiwdafigkyqiekalpifdvltisatgtemngnavitnektkekygvsskalypkvsi
    idpsvqftlpkeqtvygavdaishileyyfdgsspeisneiaegtirtimkmterliekp
    ddyearanlawsatialngtmavgrrggewachriehslsalydiahgaglaivfpawmk
    yvyrknpaqferfakkifgfegegeelilkgieafknwlkkvgapvslkdagipeedidk
    ivdnvmllveknlkpkgaslgrimvleredvreilklaak