PDB entry 1vlg

View 1vlg on RCSB PDB site
Description: crystal structure of ferritin (tm1128) from thermotoga maritima at 2.00 a resolution
Deposited on 2004-07-23, released 2004-08-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vlga_
  • Chain 'B':
    Domains in SCOP 1.71: d1vlgb_
  • Chain 'C':
    Domains in SCOP 1.71: d1vlgc_
  • Chain 'D':
    Domains in SCOP 1.71: d1vlgd_
  • Chain 'E':
    Domains in SCOP 1.71: d1vlge_
  • Chain 'F':
    Domains in SCOP 1.71: d1vlgf_
  • Chain 'G':
    Domains in SCOP 1.71: d1vlgg_
  • Chain 'H':
    Domains in SCOP 1.71: d1vlgh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlgA (A:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgA (A:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlgB (B:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgB (B:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlgC (C:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgC (C:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vlgD (D:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgD (D:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vlgE (E:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgE (E:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vlgF (F:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgF (F:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vlgG (G:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgG (G:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vlgH (H:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgH (H:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre