PDB entry 1vkx

View 1vkx on RCSB PDB site
Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna
Deposited on 1997-09-17, released 1998-12-09
The last revision prior to the SCOP 1.63 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vkxA (A:)
    ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelkicr
    vnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppya
    dpslqapvrvsmqlrrpsdrelsepmefqylpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vkxB (B:)
    gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
    tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
    cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
    pdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkddi
    qirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdvnitkpasvfvqlrrksdle
    tsepkpflyype