PDB entry 1vks

View 1vks on RCSB PDB site
Description: nmr structure of human insulin mutant his-b10-asp, pro-b28-lys, lys-b29-pro, 10 structures
Deposited on 1996-10-14, released 1997-04-01
The last revision prior to the SCOP 1.59 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1vks.1
• Chain 'B':
  Domains in SCOP 1.59: d1vks.1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vksA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vksB (B:)
  fvnqhlcgsdlvealylvcgergffytkpt