PDB entry 1vkn

View 1vkn on RCSB PDB site
Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
Class: oxidoreductase
Keywords: TM1782, N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-06-11, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ARGC, TM1782
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2A2 (12-350)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (221)
      • modified residue (244)
      • modified residue (282)
      • modified residue (301)
      • modified residue (303)
      • modified residue (313)
      • modified residue (331)
      • modified residue (334)
    Domains in SCOPe 2.07: d1vkna1, d1vkna2, d1vkna3
  • Chain 'B':
    Compound: N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ARGC, TM1782
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2A2 (12-350)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (221)
      • modified residue (244)
      • modified residue (282)
      • modified residue (301)
      • modified residue (303)
      • modified residue (313)
      • modified residue (331)
      • modified residue (334)
    Domains in SCOPe 2.07: d1vknb1, d1vknb2, d1vknb3
  • Chain 'C':
    Compound: N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ARGC, TM1782
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2A2 (12-350)
      • modified residue (12)
      • modified residue (221)
      • modified residue (244)
      • modified residue (282)
      • modified residue (301)
      • modified residue (303)
      • modified residue (313)
      • modified residue (331)
      • modified residue (334)
    Domains in SCOPe 2.07: d1vknc1, d1vknc2
  • Chain 'D':
    Compound: N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ARGC, TM1782
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2A2 (12-350)
      • modified residue (12)
      • modified residue (221)
      • modified residue (244)
      • modified residue (282)
      • modified residue (301)
      • modified residue (303)
      • modified residue (313)
      • modified residue (331)
      • modified residue (334)
    Domains in SCOPe 2.07: d1vknd1, d1vknd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vknA (A:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknA (A:)
    hmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefd
    pekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyen
    ikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsga
    grkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgils
    tiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntl
    ilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vknB (B:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknB (B:)
    hmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefd
    pekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyen
    ikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsga
    grkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgils
    tiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntl
    ilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vknC (C:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknC (C:)
    miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdp
    ekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyeni
    krvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsgae
    kvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyv
    ktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntlilms
    aidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vknD (D:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknD (D:)
    miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdp
    ekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyeni
    krvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsgek
    vdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvk
    tdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsa
    idnlvkgasgqavqnmnimfgldetkgleftpiyp