PDB entry 1vjz

View 1vjz on RCSB PDB site
Description: Crystal structure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution
Class: endoglucanase
Keywords: TM1752, ENDOGLUCANASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2004-04-08, released 2004-04-13
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Thermotoga maritima
    Gene: TM1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X274 (Start-340)
      • modified residue (44)
      • modified residue (56)
      • modified residue (159)
      • modified residue (271)
      • modified residue (333)
    Domains in SCOP 1.75: d1vjza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjzA (A:)
    mgsdkihhhhhhmnntiprwrgfnlleafsikstgnfkeedflwmaqwdfnfvripmchl
    lwsdrgnpfiiredffekidrvifwgekygihicislhrapgysvnkeveektnlwkdet
    aqeafihhwsfiarrykgissthlsfnlineppfpdpqimsvedhnslikrtiteirkid
    perliiidglgygnipvddltientvqscrgyipfsvthykaewvdskdfpvpewpngwh
    fgeywnrekllehyltwiklrqkgievfcgemgaynktphdvvlkwledlleifktlnig
    falwnfrgpfgildserkdveyeewyghkldrkmlellrky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjzA (A:)
    iprwrgfnlleafsikstgnfkeedflwmaqwdfnfvripmchllwsdrgnpfiiredff
    ekidrvifwgekygihicislhrapgysvnkeveektnlwkdetaqeafihhwsfiarry
    kgissthlsfnlineppfpdpqimsvedhnslikrtiteirkidperliiidglgygnip
    vddltientvqscrgyipfsvthykaewvdskdfpvpewpngwhfgeywnrekllehylt
    wiklrqkgievfcgemgaynktphdvvlkwledlleifktlnigfalwnfrgpfgildse
    rkdveyeewyghkldrkmlellrky