PDB entry 1vjx

View 1vjx on RCSB PDB site
Description: Crystal structure of putative ferritin-like diiron-carboxylate protein (TM1526) from Thermotoga maritima at 2.30 A resolution
Class: structural genomics, unknown function
Keywords: TM1526, PUTATIVE FERRITIN-LIKE DIIRON-CARBOXYLATE PROTEIN, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2004-04-01, released 2004-04-13
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative ferritin-like diiron-carboxylate protein TM1526
    Species: Thermotoga maritima
    Gene: TM1526
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1L2 (12-156)
      • cloning artifact (8-11)
      • modified residue (12)
      • modified residue (64)
      • modified residue (151)
    Domains in SCOP 1.75: d1vjxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjxA (A:)
    mgsdkihhhhhhmkvsdiltvairleeegerfyrelsehfngeikktfleladqerihae
    ifrkmsdqenwdevdsylagyafyevfpdtseilrrkdltlkevldiaisvekdsiilyy
    elkdglvnsdaqktvkkiidqekehlrkllemkrest
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjxA (A:)
    hhhhmkvsdiltvairleeegerfyrelsehfngeikktfleladqerihaeifrkmsdq
    enwdevdsylagyafyevfpdtseilrrkdltlkevldiaisvekdsiilyyelkdglvn
    sdaqktvkkiidqekehlrkllemkrest