PDB entry 1vjt

View 1vjt on RCSB PDB site
Description: Crystal structure of Alpha-glucosidase (TM0752) from Thermotoga maritima at 2.50 A resolution
Deposited on 2004-03-22, released 2004-03-30
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjtA (A:)
    mgsdkihhhhhhmkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasy
    ilarkyveelnspvkivktssldeaidgadfiintaypydpryhdsgsqrwdevtkvgek
    hgyyrgidsqelnmvstytyvlssypdmklaleiaekmkkmapkaylmqtanpvfeitqa
    vrrwtganivgfchgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedaypll
    dewiekklpewepknpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfg
    kfggidneverpkfheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhip
    finaiannkrvrlflnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikify
    lwprilrmewnleayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyk
    ekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjtA (A:)
    hhmkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasyilarkyveel
    nspvkivktssldeaidgadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsq
    elnmvstytyvlssypdmklaleiaekmkkmapkaylmqtanpvfeitqavrrwtganiv
    gfchgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpe
    wepknpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneve
    rpkfheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkr
    vrlflnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwprilrmew
    nleayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyke