PDB entry 1vjj

View 1vjj on RCSB PDB site
Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium
Class: transferase
Keywords: Transglutaminase 3, X-ray crystallography, metalloenzyme, calcium ion
Deposited on 2004-02-24, released 2004-03-02
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-glutamine glutamyltransferase E
    Species: HOMO SAPIENS
    Gene: TGM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08188 (0-691)
      • engineered (263)
    Domains in SCOP 1.75: d1vjja1, d1vjja2, d1vjja3, d1vjja4
  • Chain 'B':
    Compound: Protein-glutamine glutamyltransferase E
    Species: HOMO SAPIENS
    Gene: TGM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08188 (0-691)
      • engineered (263)
    Domains in SCOP 1.75: d1vjjb1, d1vjjb2, d1vjjb3, d1vjjb4
  • Heterogens: CL, CA, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjjA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswngsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjjA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswngsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpepsiigklkvagmlavgke
    vnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpikisya
    qyerylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvqmlfs
    npldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqlladfscn
    kfpaikamlsidvae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vjjB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswngsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjjB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswngsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklleteeqepsiigklkvagmla
    vgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpik
    isyaqyerylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvq
    mlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqllad
    fscnkfpaikamlsidvae