PDB entry 1vj6

View 1vj6 on RCSB PDB site
Description: PDZ2 from PTP-BL in complex with the C-terminal ligand from the APC protein
Class: Hydrolase/Signaling Protein
Keywords: PDZ, complex, APC, NMR, protein-protein interaction, PTP-BL, C-terminus, Hydrolase/Signaling Protein COMPLEX
Deposited on 2004-02-03, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine-phosphatase (nonreceptor type 13)
    Species: Mus musculus [TaxId:10090]
    Gene: PTP-BL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64512 (8-101)
      • cloning artifact (7)
    Domains in SCOPe 2.08: d1vj6a1, d1vj6a2
  • Chain 'B':
    Compound: adenomatous polyposis coli protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vj6A (A:)
mhhhhhhmkpgdtfevelaktdgslgisvtggvntsvrhggiyvkaiipkgaaesdgrih
kgdrvlavngvslegathkqavetlrntgqvvhlllekgqvp

    Sequence, based on observed residues (ATOM records): (download) 
    >1vj6A (A:)
mkpgdtfevelaktdgslgisvtggvntsvrhggiyvkaiipkgaaesdgrihkgdrvla
vngvslegathkqavetlrntgqvvhlllekgqvp

  • Chain 'B':
    No sequence available.