PDB entry 1vio

View 1vio on RCSB PDB site
Description: Crystal structure of pseudouridylate synthase
Class: Lyase
Keywords: structural genomics
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-30, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.196
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal small subunit pseudouridine synthase a
    Species: Haemophilus influenzae
    Gene: RSUA, HI1243
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45124 (3-End)
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1vioa1, d1vioa2
  • Chain 'B':
    Compound: ribosomal small subunit pseudouridine synthase a
    Species: Haemophilus influenzae
    Gene: RSUA, HI1243
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45124 (3-End)
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1viob1, d1viob2
  • Heterogens: BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vioA (A:)
    mslrldkfiaenvgltrsqatkairqsavkingeivksgsvqisqedeiyfedelltwie
    egqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqws
    hritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlti
    segryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklveggshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vioA (A:)
    slrldkfiaenvgltrsqatkairqsavkingeivksgsvqisqedeiyfedelltwiee
    gqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwshri
    tspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltiseg
    ryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vioB (B:)
    mslrldkfiaenvgltrsqatkairqsavkingeivksgsvqisqedeiyfedelltwie
    egqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqws
    hritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlti
    segryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklveggshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vioB (B:)
    slrldkfiaenvgltrsqatkairqsavkingeivksgsvqisqedeiyfedelltwiee
    gqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwshri
    tspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltiseg
    ryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv