PDB entry 1vin

View 1vin on RCSB PDB site
Description: bovine cyclin a3
Class: binding protein
Keywords: cyclin, cell cycle, kinase-regulatory-subunit, binding protein
Deposited on 1996-03-15, released 1996-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 1996-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin a
    Species: BOS TAURUS
    Gene: BOVINE CYCLIN A3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vina1, d1vina2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vinA (A:)
    gvnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
    tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
    vlrmehlvlkvlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylky
    lpsviaaaafhlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsir
    ekyknskyhgvsllnppetlnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vinA (A:)
    dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
    rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
    vlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaaf
    hlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhg
    vsllnppetlnl