PDB entry 1vif

View 1vif on RCSB PDB site
Description: structure of dihydrofolate reductase
Deposited on 1996-10-03, released 1997-10-22
The last revision prior to the SCOP 1.61 freeze date was dated 1997-10-22, with a file datestamp of 1997-10-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1vif__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vif_ (-)
    psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin