PDB entry 1vho

View 1vho on RCSB PDB site
Description: crystal structure of a putative peptidase/endoglucanase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhoA (A:)
    mslkmetgkllmelsnldgpsgyetnvvsyiksviepfvdeakttrhgsligykkgkgig
    klaffahvdeigfvvskvegqfarlepvggvdpkvvyaskvriytkngiergvigmlaph
    lqdsesrkkvptydeifvdlslcergvrvgdiavidqtafetngkvvgkaldnrascgvl
    vkvleflkrydhpwdvyvvfsvqeetgclgaltgayeinpdaaivmdvtfaseppfsdhi
    elgkgpviglgpvvdrnlvqkiieiakkhnvslqeeavggrsgtetdfvqlvrngvrtsl
    isiplkymhtpvemvdprdveelarllslvaveleveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhoA (A:)
    metgkllmelsnldgpsgyetnvvsyiksviepfvdeakttrhgsligykkgkgigklaf
    fahvdeigfvvskvegqfarlepvyaskvriytkngiergvigmlaphlqdsesrkkvpt
    ydeifvdlslcergvrvgdiavidqtafetngkvvgkaldnrascgvlvkvleflkrydh
    pwdvyvvfsvqeetgclgaltgayeinpdaaivmdvtfaseppfsdhielgkgpviglgp
    vvdrnlvqkiieiakkhnvslqeeavggrtdfvqlvrngvrtslisiplkymhtpvemvd
    prdveelarllslvavele