PDB entry 1vhb

View 1vhb on RCSB PDB site
Description: bacterial dimeric hemoglobin from vitreoscilla stercoraria
Class: oxygen transport
Keywords: heme, respiratory protein, oxygen transport
Deposited on 1997-02-19, released 1998-02-25
The last revision prior to the SCOP 1.75 freeze date was dated 1998-02-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Vitreoscilla stercoraria
    Gene: VGB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vhba_
  • Chain 'B':
    Compound: hemoglobin
    Species: Vitreoscilla stercoraria
    Gene: VGB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vhbb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhbA (A:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhbA (A:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhbB (B:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav