PDB entry 1vge

View 1vge on RCSB PDB site
Description: tr1.9 fab fragment of a human igg1 kappa autoantibody
Class: immunoglobulin
Keywords: tr1.9, anti-thyroid peroxidase, autoantibody, immunoglobulin
Deposited on 1996-01-04, released 1996-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: tr1.9 fab
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA DERIVED FROM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgeh1, d1vgeh2
  • Chain 'L':
    Compound: tr1.9 fab
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA DERIVED FROM
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA65058 (0-211)
      • insertion (2-3)
      • conflict (10)
      • conflict (19)
      • conflict (21)
      • conflict (31)
      • conflict (44)
      • conflict (49)
      • conflict (52)
      • conflict (54)
      • conflict (71)
      • conflict (82)
      • conflict (84)
      • conflict (90)
      • conflict (93)
      • conflict (95)
      • conflict (99)
      • conflict (190)
    Domains in SCOPe 2.06: d1vgel1, d1vgel2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vgeH (H:)
    qvklleqsgaevkkpgasvkvsckasgysftsyglhwvrqapgqrlewmgwisagtgntk
    ysqkfrgrvtftrdtsattaymglsslrpedtavyycardpygggksefdywgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vgeL (L:)
    elvmtqspsslsasvgdrvniacrasqgissalawyqqkpgkaprlliydasnlesgvps
    rfsgsgsgtdftltisslqpedfaiyycqqfnsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec