PDB entry 1vft

View 1vft on RCSB PDB site
Description: Crystal structure of L-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae
Deposited on 2004-04-19, released 2004-09-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vftA (A:)
    mnetptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaaw
    lgtatpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraa
    grtariqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsi
    rlqldafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgt
    paqlglrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgr
    gpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtia
    yeivtriggrvprvylgglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vftA (A:)
    tptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlgt
    atpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagrt
    ariqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirlq
    ldafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpaq
    lglrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgrgpv
    lvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtiayei
    vtriggrvprvylgglehhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vftB (B:)
    mnetptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaaw
    lgtatpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraa
    grtariqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsi
    rlqldafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgt
    paqlglrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgr
    gpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtia
    yeivtriggrvprvylgglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vftB (B:)
    ptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlgta
    tpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagrta
    riqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirlql
    dafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpaql
    glrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgrgpvl
    vagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtiayeiv
    triggrvprvylgglehhhh