PDB entry 1vfh

View 1vfh on RCSB PDB site
Description: Crystal structure of alanine racemase from D-cycloserine producing Streptomyces lavendulae
Class: isomerase
Keywords: TIM-barrel, Greek-key motief, ISOMERASE
Deposited on 2004-04-13, released 2004-09-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine racemase
    Species: Streptomyces lavendulae [TaxId:1914]
    Gene: alr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1vfha1, d1vfha2
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfhA (A:)
    mnetptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaaw
    lgtatpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraa
    grtariqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsi
    rlqldafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgt
    paqlglrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgr
    gpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtia
    yeivtriggrvprvylgglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfhA (A:)
    etptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlg
    tatpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagr
    tariqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirl
    qldafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpa
    qlglrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgrgp
    vlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtiaye
    ivtriggrvprvylgglehhhh