PDB entry 1vfh

View 1vfh on RCSB PDB site
Description: Crystal structure of alanine racemase from D-cycloserine producing Streptomyces lavendulae
Deposited on 2004-04-13, released 2004-09-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vfhA (A:)
    mnetptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaaw
    lgtatpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraa
    grtariqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsi
    rlqldafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgt
    paqlglrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgr
    gpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtia
    yeivtriggrvprvylgglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vfhA (A:)
    etptrvyaeidldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlg
    tatpeealelraagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagr
    tariqlkadtglgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirl
    qldafrdmlayaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpa
    qlglrpamtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgrgp
    vlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtiaye
    ivtriggrvprvylgglehhhh