PDB entry 1ver

View 1ver on RCSB PDB site
Description: Structure of New Antigen Receptor variable domain from sharks
Class: immune system
Keywords: ig vnar, native, 12y-1, immune system
Deposited on 2004-04-05, released 2004-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.17
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: new antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vera_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1verA (A:)
    awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
    kgsksfslrirdlrvedsgtykcgafrfwlpygygslplsekgagtvltvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1verA (A:)
    awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
    kgsksfslrirdlrvedsgtykcgafrlsekgagtvltvk