PDB entry 1ver

View 1ver on RCSB PDB site
Description: Structure of New Antigen Receptor variable domain from sharks
Deposited on 2004-04-05, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.17
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vera_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1verA (A:)
    awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
    kgsksfslrirdlrvedsgtykcgafrfwlpygygslplsekgagtvltvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1verA (A:)
    awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
    kgsksfslrirdlrvedsgtykcgafrlsekgagtvltvk