PDB entry 1veo

View 1veo on RCSB PDB site
Description: Crystal Structure Analysis of Y164F/maltose of Bacillus cereus Beta-Amylase at pH 4.6
Class: hydrolase
Keywords: beta-alpha-barreels, optimum pH, Y164F, HYDROLASE
Deposited on 2004-04-03, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36924 (0-515)
      • engineered (163)
    Domains in SCOPe 2.07: d1veoa1, d1veoa2
  • Heterogens: GLC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1veoA (A:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakiflsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw